SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033070 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033070
Domain Number 1 Region: 16-374
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.02e-69
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 394-509,628-768
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.13e-68
Family Phosphate binding protein-like 0.000000000655
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000033070
Domain Number - Region: 480-623
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00208
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033070   Gene: ENSRNOG00000000368   Transcript: ENSRNOT00000037559
Sequence length 872
Comment pep:known chromosome:Rnor_5.0:20:55397877:55872312:-1 gene:ENSRNOG00000000368 transcript:ENSRNOT00000037559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKAC
DQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSL
SRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLK
EMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNM
TGFRILNTENTQVSSIIEKWSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQ
FPQMTVSSLQCNRHKPWRFGTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKE
EGLEKIGTWDPASGLNMTESQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGN
DRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAP
LAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSC
VLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIV
GGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKK
SKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIG
GLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALG
VQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLK
HKPQAPVIVKTEEVINMHTFNDRRLPGKETMA
Download sequence
Identical sequences ENSRNOP00000033070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]