SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033830 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033830
Domain Number 1 Region: 103-188
Classification Level Classification E-value
Superfamily E set domains 0.000000000217
Family Filamin repeat (rod domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033830   Gene: ENSRNOG00000027847   Transcript: ENSRNOT00000037353
Sequence length 554
Comment pep:novel chromosome:Rnor_5.0:8:58910946:58935378:-1 gene:ENSRNOG00000027847 transcript:ENSRNOT00000037353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPILTPRTLLSLLPNASARKLFLMVLIIFVFWVVFMTSKDHTEFMFHLKNPIILRRWSIF
KEFLPSEELQNTPSSVEADMAILEKLNQQIPPRPFLNHSSTTSAKHSTATILNPQRVYCI
GDQLDVLLVAKDYFGHRKEYGGDFLRARMSSPALKAGASGKVTDFNNGTYLVSFTLFWEG
RVSLSILLMHPSEGVSALWRARNQGYDRIIFTGQFLNGTAHVLTECGLSLNTSGELCQYL
DARDHEAFYCLKLRGVPCEALTHMTTKNSDVSYLSLKEKLLFRRFNIGVEVVKNLAITVS
PCKNKTESKKRKCQIGMETPFPSGYTLRGRWITSHCEQNEFREIKYINNCLARKLIYLMG
DSTLRQWIYYLHQVVKTLKFFDHHGSGLFKTHILLDTERHTLVQWKKHSHPFVTQKLFSM
KDDNYIPREIDQVAGDSGTAIVISFGQHFRPFPINIFIRRAINVKKAIERLFLRSPETKV
IIKTENIREISENAELFSDFHGSIQNLIIRDVFRDLNVGIIDAWDMTIAYRSENVHPPDS
VIESQIGMFLNYIC
Download sequence
Identical sequences D4A1D7
ENSRNOP00000033830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]