SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033874 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033874
Domain Number 1 Region: 244-343
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.03e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00000223
Further Details:      
 
Domain Number 2 Region: 95-200
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000128
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 12-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000576
Family HLH, helix-loop-helix DNA-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033874   Gene: ENSRNOG00000021318   Transcript: ENSRNOT00000034991
Sequence length 874
Comment pep:known chromosome:Rnor_5.0:6:20299621:20377837:1 gene:ENSRNOG00000021318 transcript:ENSRNOT00000034991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG
LTQVELTGHSIFDFTHPCDHEEIRENLTLKTGSGFGKKNKDMSTERDFFMRMKCTVTNRG
RTVNLKSATWKVLHCTGQVRVYNNCPPHSSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD
SKTFLSRHSMDMKFTYCDDRILELVGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG
QVVSGQYRMLAKHGGYVWLETQGTVVYNPRNLQPQCIMCVNYVLVGIEKNDVVFSMDQTE
SLFKPHLMAMNSIFDSSDDVALSEKSNYLFTKLKEEPEDLAQLAPTPGDAIISLDFGGQN
FDESSTYGKAILPPGQPWATELRSHSAQSESRSLPAFTVPQAGSPGNATPSATSSSSCST
PSSPEDYYSSLENHLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQ
LSPICPEEPLVPESPQPNPQHCFSTMSSIFQPLTPGASQGTFFLDKYPQQLESRKTESEH
WPMSTIFFDAGSKGSLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWSVGNQSAEP
LGPLPLGTSQLEPPSTPPHVSMFKMRSAKDFGARGPYMMSPAMIALSNKLKLKRQLDYEE
PAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCPLMPDKTVSASMAPDEFTQKSMRGLGQP
LRHLPPSQPPSTRSPGENAKSGFPPQCYASPFQDYSPPGAQKGSGVASRLLGPSFEPYLL
PELTRYDCEVNVPVPGSSTLLQGRDLLRALDQAT
Download sequence
Identical sequences ENSRNOP00000033874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]