SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034042 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034042
Domain Number 1 Region: 50-153
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.82e-27
Family Ribosomal proteins L24p and L21e 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034042   Gene: ENSRNOG00000022234   Transcript: ENSRNOT00000035271
Sequence length 216
Comment pep:known chromosome:Rnor_5.0:2:206691661:206697673:1 gene:ENSRNOG00000022234 transcript:ENSRNOT00000035271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSALLALASKATLSPHYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGD
MVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDHRGTMIPSEAPLLHHQV
KLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTDGPKDTSVE
DALERTYVPRLKTLEEDVMEAMGIQETRRFKKIYWY
Download sequence
Identical sequences Q66H47
10116.ENSRNOP00000034042 ENSRNOP00000034042 NP_001007638.1.100692 NP_001007638.1.4139 XP_006232666.1.100692 XP_006232667.1.100692 XP_006232669.1.100692 XP_006232670.1.100692 ENSRNOP00000034042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]