SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034518 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034518
Domain Number 1 Region: 124-355
Classification Level Classification E-value
Superfamily vWA-like 2.74e-25
Family Integrin A (or I) domain 0.0005
Further Details:      
 
Domain Number 2 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000314
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 550-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family Integrin beta EGF-like domains 0.0011
Further Details:      
 
Domain Number 4 Region: 379-467
Classification Level Classification E-value
Superfamily Integrin domains 0.0000366
Family Integrin domains 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000034518
Domain Number - Region: 639-701
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0017
Family Integrin beta tail domain 0.013
Further Details:      
 
Domain Number - Region: 600-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00725
Family Integrin beta EGF-like domains 0.05
Further Details:      
 
Domain Number - Region: 516-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034518   Gene: ENSRNOG00000028203   Transcript: ENSRNOT00000032340
Sequence length 709
Comment pep:known_by_projection chromosome:Rnor_5.0:11:40320315:40334704:-1 gene:ENSRNOG00000028203 transcript:ENSRNOT00000032340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLGRCTLLPILAGLLSLGSGEVHEPCTKDKMGTCQDCIQSGPSCAWCQKLNFTGQGEPNS
VHYDTPEQLLLLKGCTSEYLVDPKSLAEPQEDKERDQKPPSPNVTVFLRPGQTATFKVNF
QWTQDNSVNLYFLIGLSGSVQGHHSNIQTLGSDLLQALSEITKSGHSHYRLLAQLLPISW
ATPTPEHTCAHCPQTYTQFCLLTCAHMYKYPHVPYLLTTSTSSHFQMELKKQLVSGKLDT
PPPRTTGCYGASCHVPDISSPERNHWCNRTRFLVLATDNDFHFAKDKTQGTRQNTSDGHC
HLKDSMYRSPGEPDYQSVVQLVSKRAENNIRPIFMVPSRMVKTYEKLTTFIPKLNIRNLV
HASPQTCLMQILSPSSYLKLSSRVILDHSTIPSILTITHDSYHSNRTSSTGKSRGNCSHV
QINDHLSLDGNIKALPKCFQEQFFFIQALGFTSVTVRILPCKCQCREQSRQNSLCGGKGV
VECVYRLTGNFTQQKTEIQKQARTGDKELEGSFQKDNSSVCSGLGYCICGQCVCHTSDIP
NQVISGQYCECDNVNCERYDGQVCGGPWRGLCACSQCSCKDGFEGSACQCRTPTVGCPRQ
AIECSGHGRCHCNRCSCDPGYQPPLREECPGCFFPATSTNKCPSCTPVHTDPTVQPNIQT
ECWNLLHSPTPLNDKTRMTEWDSEGCHMTYTLYRQDQDDINPIYIKDSR
Download sequence
Identical sequences ENSRNOP00000034518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]