SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000035601 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000035601
Domain Number 1 Region: 47-521
Classification Level Classification E-value
Superfamily ALDH-like 5.37e-167
Family ALDH-like 0.0000000849
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000035601   Gene: ENSRNOG00000023538   Transcript: ENSRNOT00000031384
Sequence length 523
Comment pep:known chromosome:Rnor_5.0:17:44000891:44023629:1 gene:ENSRNOG00000023538 transcript:ENSRNOT00000031384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFLLRNFCAARPALRPPGRLLREPAGAQRRSYVGGPADLHADLLRGDSFVGGRWLPT
PATFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFSSWKEISVKERSSLLRKWYDLMI
QNKDELAKIITAESGKPLKEAQGEILYSAFFLEWFSEEARRVYGDIIYTSAKDKRGLVLK
QPVGVASIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPYSALALAQLANQAGIPPG
VYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKILLHHAANSVKRVSMELGGLAP
FIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDSFVTKFAEAMKKSLRVGN
GFEEGTTQGPLINEKAVEKVEKHVNDAVAKGATVVTGGKRHQSGGNFFEPTLLSNVTRDM
LCITEETFGPLAPVIKFDKEEEAVAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGV
NEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCYGGL
Download sequence
Identical sequences G3V945
ENSRNOP00000035601 10116.ENSRNOP00000035601 ENSRNOP00000044002 NP_074042.1.100692 NP_074042.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]