SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036336 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036336
Domain Number 1 Region: 43-244
Classification Level Classification E-value
Superfamily L domain-like 6.63e-38
Family Polygalacturonase inhibiting protein PGIP 0.084
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000036336
Domain Number - Region: 437-485
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0942
Family B3/B4 domain of PheRS, PheT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036336   Gene: ENSRNOG00000024796   Transcript: ENSRNOT00000034284
Sequence length 580
Comment pep:known chromosome:Rnor_5.0:5:174789385:174799217:1 gene:ENSRNOG00000024796 transcript:ENSRNOT00000034284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAMAVSEAWPELELAERERRRELLLTGPGLEERVKAAGGRLPPRLFTLPLLHYLEVSG
CGSLRAPGPGLAQGLPQLHSLVLRRNALGPGLSPELGPLPALRVLDLSGNALETLPPGEG
LGPAEPPGLPQLQSLNLSGNRLRELPADLARCAPRLQSLNLTGNCLDSFPAELFRPGALP
LLSELAAADNCLRELSPDIAHLASLKTLDLSNNQLTEIPAELADCPKLKEINFRGNRLRD
KRLEKMVGGCQTKSILEYLRAGGRGGRSKGRQEGSEKEDRKKKRDRKQRRESGEGEEEVA
DSARLMLKVLHVSENPTPLTVRVSPEVRDVRPYIVGAVVRGMDLQPGNALRRFLNSQTKL
HDDLCEKRTAATIATHDLQAVRGPLLYAARPPEDLKIVPLGRKEAKAKELVRQLQLEAEE
QRKQKKRQSVSGLHRYLHLLDGKENYPCLVDAEGDVISFPPITNSEKTKIKRTTCSVFLE
VTSATSLQLCKDIMDSLVLKMAELNKSTSENKEEDMLSGTETDASHGLSDPNLNPRAGKD
GQCPLVVEQVRVVDLEGSLKVVYPSKADLVTLPPYVTVVR
Download sequence
Identical sequences F1LT49
NP_001129138.1.100692 NP_001129138.1.4139 ENSRNOP00000036336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]