SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000036704 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000036704
Domain Number 1 Region: 63-187
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.000000000235
Family Band 7/SPFH domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000036704   Gene: ENSRNOG00000028692   Transcript: ENSRNOT00000032954
Sequence length 261
Comment pep:novel chromosome:Rnor_5.0:20:40082358:40083164:1 gene:ENSRNOG00000028692 transcript:ENSRNOT00000032954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAADVSESIGNFGLTLAVAGGVVNSAFCNVDAGHRAVISDRFHGIQDIVVGEQTHFLIPW
VQKPIIFNWTVDCTGRKDLQNIHITLCILFQPMASQLPIYTSIGEDFDEQVLPPITSEIF
KLVVSRFDAEELITQRELVSRHVSDDLTEQSAIFGLILDDMSLTHLTFGKEFTEAVGAKQ
VAQRKAETARSSEEKKKAAIISAESDSKATEPLANALATACDGLIEQQKLDAAEDIVHQL
SRSWNITYWPAGQSVLLQLPQ
Download sequence
Identical sequences ENSRNOP00000036704 10116.ENSRNOP00000036704 ENSRNOP00000036704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]