SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037261 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000037261
Domain Number - Region: 106-132,188-272
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000604
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number - Region: 43-181,223-254
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000942
Family Tricorn protease domain 2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037261   Gene: ENSRNOG00000023541   Transcript: ENSRNOT00000035875
Sequence length 2240
Comment pep:known chromosome:Rnor_5.0:13:103034524:103084625:-1 gene:ENSRNOG00000023541 transcript:ENSRNOT00000035875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDLTAQVTSDLLQFPEVTIEALGEDEITLESVLRGKFAAGKNGLACLACGPQLEVVNSL
TGERLSAYRFSGVNEQPPVVLAVKEFSWHKRTGLLIGLEEADGSVLCLYDLGISRVVKAV
VLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAVVTDVGQILLIDLCLDDLSCSQN
EVEASDLEVITGIPAEVPHIRESVMREGRHLCFQLVSPSGVAISTLSYINRTNQLAVGFA
DGYLALWNMKSMKREYYTQLEGGRVPVYAVVFQEPENDPRNCCYLWAVQSTQESEGDVVS
LHLLQLAFGDRKCLASGQILYEGLEYCEERYTLDLSGGMFPLRGQTSNTKLLGCQSIERF
PSHGDREESMREALSPDTSVSVFTWQVNIYGQGEPSVYLGLFDINRWYHAQMPDSLRSGE
SLHNCSYFALWSLESVVSRTSPHHILDILVHERSLSRGVPPSYPPPEQFFNPSTFNFDAT
CLLNSGVIHVTCTGFQKETLTFLKKSGPTLNEVIPDSYNRCLVAGLLSPRLIDIQPSSLS
QEEQLEAILSAAIQTSSLGLLTGYIRTWIIEEQPNSAANLRFVLEWTWNKVILTKEDFDR
LCVPLFDGSCRFIDPQTIQSIQQCHLLLSNLSTVLSCFAMEAQGITERGLVDLNNKHMVT
QLICQYAQMVLWFCHSGLLPEGLDDTLQLSRLRYNYPVIQNYYTSRRQKCERSPRGKWSR
DCLLIDGLVSQLGDEVEKLWKRDEGGTGKYPPASIHALLDIYLLDNISEASKHAITIYLL
LDIMYSFPNKTDTPIESFPTAFAISWGQVKLVQGFWLLDHNDYENGLDLLFHPVTAKPAS
WQHSKIIEAFMSQGEHKQALRYLQTMKPTVSSSSDVLLHLSVLLFNRCMVEAWNLLRQNS
NTVNIEELLKHAYEVCQEMGLMEDLLKLPFTNTEQECLVNFLQSSSSVQNHEFLLVHHLQ
RANYISALKLNQTLKNNLTSDRDPRLRERSVTRNSILDQYGKILPRVQRKLAVERAKPYH
LSTSSVFQEVSRPKPLSAFPKKALTGTVITRSTFISNVLSKIGEVWASHEPRNGISLFNS
PKTEQPSPVVHSFPHPELPEAFVGTPISNPSQRISRLLDLVVHPIPQPSQRLEFIQQSPT
RSPLCLLSSSLPLSSQLKRPHQQASRPSELLLLETPLIVKKAKSLALSATSSGFAEFTPP
SILRSGLRTTSLASPSQSPGRSLTPPFRLKETRISFMEEGMNTHWTDTATDDRNAKAFVS
TSFHKCGLPAETEWMKTNDKNTYFPLDVPAKVPQKVVAESLDTHSPRSLEKLDVSKDSTV
SSRSDQTLEYHDAPSPEDLEGGVFVSPKPASSSTELTTNSMVQTEKDNDKNLFKSEGTPS
AMEKQIGTIEASVEAFSEFSHLDPVERAEASLGVSSVREGETSTSKSKTSVLDGIVSIES
RTSIPIADHNEFVANKVEDVESSESTTSKCPVTSERSLDKELTLNLKGDEMEAVVPKESV
GLPEERPQTSAGPSDTQEIHLIGCEKLEVQNSEEVAKSLSFPELCPLGAHRPQYNFDVIE
QQFRDLPDDKDSAECDVAEVDGELFVAQSNFSLILEGEEGEVEASDSNVLPKVTNIATKE
KPVSCEEPDNEGHVTDLPSAVTGDQESHKVETLPYVPEPVKVAIAENLLDVIKDTRSKEA
THVAAVEDVDEDRAVMIPKAAHPSRLTNSTPKTVKERRAETVSASQGDDSIAPRTLTRRQ
RALSLNVTSEQEPSAAATPQKKTRKVKETREFSESTCSDVKVAPENQLTAPSPSPSRRGR
KKKDLGQGPLATSGAVEEPQATPERLRLRVQPPEPAAEETPSRAKAKLSSARKGTPRRLR
KSIEDGPSADIVNEVRGRKAAGHGRTVRELRSASVEDTQKMEYEQDEERGDQQLPLKRKR
VREREDSVSGVTEEPKLDSSQLTLQVGLDVPATPRKRGRRPKRVVPLGADGTTPGKEQTS
PQKEGPVVRRSTRNTPARNVSTLEKPILVPNKEAATVMTSKKKPTKKSADGSPKGPFPAV
SDLADEAAHRESTDQGVLTSAAFTTPSWSTRTRSRRTMLLTDISEPQTEPLLSSPSLKVP
KKETKAKNMEAAAQLKELVSDISSRFVVSPPALRTRQKSTSNASKLLGELESNPKPVEII
EQKPKRSRTVKTKVSRNTGKGSSWSPPPIEIKLISPLASPVDEIKVSKPRKTAEVAGKTL
GRGRKKPSSFPKQILRRKML
Download sequence
Identical sequences D3ZZZ0
ENSRNOP00000037261 NP_001258199.1.100692 NP_001258199.1.4139 XP_008768080.1.100692 ENSRNOP00000037261 10116.ENSRNOP00000037261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]