SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038537 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038537
Domain Number 1 Region: 1-153
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 6.81e-40
Family Bcl-2 inhibitors of programmed cell death 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038537   Gene: ENSRNOG00000047606   Transcript: ENSRNOT00000039850
Sequence length 175
Comment pep:known chromosome:Rnor_5.0:8:96059040:96067299:1 gene:ENSRNOG00000047606 transcript:ENSRNOT00000039850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDCEFMYIHSLAENYLQYVLQVPAFESAPSKTSRVLQRVAFSVQKEVEKNLKPYLDDFH
VESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVDTYKQVSS
FVAEFIMNNTGEWIQQNGGWEDGFTKKFEPKSGWLTFLQMTGKIWEMLFLLKQHY
Download sequence
Identical sequences G3V977
ENSRNOP00000038537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]