SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039045 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039045
Domain Number 1 Region: 830-1109
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.79e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000209
Further Details:      
 
Domain Number 2 Region: 1113-1391
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.65e-70
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000253
Further Details:      
 
Domain Number 3 Region: 59-290
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.93e-70
Family Carbonic anhydrase 0.0000119
Further Details:      
 
Domain Number 4 Region: 344-442
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000597
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039045   Gene: ENSRNOG00000009419   Transcript: ENSRNOT00000042010
Sequence length 1426
Comment pep:known chromosome:Rnor_5.0:15:16953386:17647514:-1 gene:ENSRNOG00000009419 transcript:ENSRNOT00000042010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGTLQESRQGSSVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGSHQSPIDILDHHARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQVSSLLPFVVSILTSFVISLL
YPTHSFKPKKMLSAGHNTASSIRMTWCHRFSRYLQGPLTLPVSSVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHISPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
ASAASKQAGRPVLATTEALASPGPDGDSAPTKDGEGAEEGEKEEKSESEDGEREQEEEEK
DSEKKEKSEATHTAAESDQTAPAPTPSSPHRTAQEGGHQTIPGHRQDHSAPVTDQPGHVD
PGLDTLVDTATQVPPTATEEHYSGSDPKRPEMPSKKPISRGDRFSEDSKFITVNPAEKNT
SGMISRPSPGRMEWIIPLIVVSALTFVCLVLLIAVLVYWRGCNKIKSKGFPRRSREVPSS
GERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIPVKQFGKHQHGFSGD
FEEVQRCTADMNITAEHSNHPDNKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANY
VDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENTE
EYGNIIVTLKSTEVHACYTVRRFSVRNTKVKKGQKGNPKGRQNERTVIQYHYTQWPDMGV
PEYALPVLTFVRRSSAARMPDMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGF
LKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSSQLHSYVNSILIPGVGGKTRLE
KQFKLITQCNAKYVECFSAQKECNKEKNRNSSVVPAERARVGLAPLPGMKGTDYINASYI
MGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSREESMN
CEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLEVRHFHAPISSTFELINVIKEE
ALARDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQ
YQFVYKAMLSLVSTKENGNGPMTGDKNGAVLTAEESDPAESMESLV
Download sequence
Identical sequences ENSRNOP00000039045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]