SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040609 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000040609
Domain Number - Region: 135-205
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0785
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040609   Gene: ENSRNOG00000009582   Transcript: ENSRNOT00000051951
Sequence length 533
Comment pep:known chromosome:Rnor_5.0:2:284774182:284804254:1 gene:ENSRNOG00000009582 transcript:ENSRNOT00000051951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQIEHPAGGYKKLFETVEELSTPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHL
FDGQALLHKFDFKEGHVTYYRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFF
SYFRGVEITDNALVNIYPVGEDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAH
PHIESDGTVYNIGNCFGKNFTVAYNIIKIPPLKADKEDPINKSEVVVQFPCSDRFKPSYV
HSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNESMGVWLHVADKKRRKYF
NNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKRNAMKA
PQPEVRRYVLPLTIDKADTGRNLVTLPHTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ
INYQKCGGKPYTYAYGLGLNHFVPDKLCKLNVKTKEIWMWQEPDSYPSEPIFVSQPDALE
EDDGVVLSVVVSPGAGQKPAYLLVLNAKDLSEIARAEVETNIPVTFHGLFKKP
Download sequence
Identical sequences O70276
ENSRNOP00000040609 NP_446014.2.100692 NP_446014.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]