SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042520 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000042520
Domain Number 1 Region: 4-129
Classification Level Classification E-value
Superfamily DNA clamp 0.0000000000000141
Family DNA polymerase processivity factor 0.02
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000042520
Domain Number - Region: 148-228
Classification Level Classification E-value
Superfamily DNA clamp 0.00122
Family DNA polymerase processivity factor 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042520   Gene: ENSRNOG00000021480   Transcript: ENSRNOT00000048454
Sequence length 398
Comment pep:known chromosome:Rnor_5.0:12:41579810:41610543:1 gene:ENSRNOG00000021480 transcript:ENSRNOT00000048454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGGQVKVFGKAIQTLSRVSDELWLDPSEKGLALRSVNSCHSTYGYVLFSSVFFQHYQWS
PSATITDSDIPLNLNCKLAIKSILPIFRCLNYLERSIEKCTMVARSDRCRVVIQFFGRHG
IKRTHNVYFQDCQPLKILFEKSLCANILMIKPRLLAEAIALLTSNQEEVTFSVTPENFCL
KSSSGESLDLTSSVYSEMSFGPEEFDFFQVGLDTEITFCFKELKGILTFSEVMHAPIAIY
FDFPGKPVVLSVEDMLLEASFILATLLDYPSRTSSPQSLRLSQARRSDPTLSGAQEGKSR
VSQTPESISRAAPKRLFPKDPPDSSSAAETRRASASQDDISEVPESVVSDMEEGQSPSPL
RKFSCMFFGAVSCEQQEHANHPLGSLAVASDSEQDASG
Download sequence
Identical sequences Q499V3
ENSRNOP00000042520 NP_001025213.1.100692 NP_001025213.1.4139 10116.ENSRNOP00000042520 ENSRNOP00000042520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]