SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042830 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000042830
Domain Number 1 Region: 309-409
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 72-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 153-179,207-226
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000284
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042830   Gene: ENSRNOG00000014448   Transcript: ENSRNOT00000046313
Sequence length 595
Comment pep:novel chromosome:Rnor_5.0:1:185007568:185105409:1 gene:ENSRNOG00000014448 transcript:ENSRNOT00000046313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSGSLSTSGVDCNRKRKGSATDYQESMDTDKDDPHGR
LEYAEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRNDLIGQSLFDYLHPKDIAKVKEQLSSS
DTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFASTCSK
KKADRKSFCTIHSTGYLKSWPPTKMGLDEDSEPDNEGCNLSCLVAIGRLHSHMVPQPVNG
EIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQ
VLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDP
TFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRG
SSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSAGLLPGQAQETPGYPYSDSSS
ILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences ENSRNOP00000042830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]