SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042920 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000042920
Domain Number - Region: 26-91
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0366
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042920   Gene: ENSRNOG00000029173   Transcript: ENSRNOT00000040366
Sequence length 122
Comment pep:novel chromosome:Rnor_5.0:3:127731012:127731380:-1 gene:ENSRNOG00000029173 transcript:ENSRNOT00000040366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPQKDKKPKKSTWRFHLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERL
KNKITVVSEKQFSKRYLKHLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDGSES
ED
Download sequence
Identical sequences D3ZSF9
10116.ENSRNOP00000042920 ENSRNOP00000042920 ENSRNOP00000042920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]