SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043232 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043232
Domain Number 1 Region: 358-591
Classification Level Classification E-value
Superfamily HCP-like 4.27e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 565-699
Classification Level Classification E-value
Superfamily HCP-like 1.96e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 198-322
Classification Level Classification E-value
Superfamily HCP-like 1.31e-24
Family HCP-like 0.0036
Further Details:      
 
Domain Number 4 Region: 116-169
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043232   Gene: ENSRNOG00000004464   Transcript: ENSRNOT00000045870
Sequence length 793
Comment pep:known chromosome:Rnor_5.0:6:124826559:124868279:-1 gene:ENSRNOG00000004464 transcript:ENSRNOT00000045870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVRVRLLLLLCAVLLGSAAASSDEETNQDESLDSKGALPTDGSVKDHTTGKVVAGQRFV
DSEDSEVESLLQDEEESSKSQEEVSVTEDISFLDSPNPSSKTYEELKRVRKPVLTAIEGT
AHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKTDEKWGFCETEEDAAKRRQMQ
EAEAIYQSGMKILNGSTRKNQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLTQNIQA
AKEMFEKLTEEGSPKGQTGLGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYRY
WAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLI
QYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYS
EGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQG
WVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHT
AVELFKNVCERGRWSERLMTAYNSYKDDDYNAAVVQYLLLAEQGYEVAQSNAAFILDQRE
ATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQ
HSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQYI
REANIRDLFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDIPVPRPPGPRPAP
PQQEGPPEQQPPQ
Download sequence
Identical sequences G3V9D3
ENSRNOP00000043232 NP_808794.2.100692 NP_808794.2.4139 ENSRNOP00000006143 10116.ENSRNOP00000043232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]