SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044602 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044602
Domain Number 1 Region: 467-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.05e-76
Family Protein kinases, catalytic subunit 0.000000292
Further Details:      
 
Domain Number 2 Region: 311-394
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-34
Family Kringle modules 0.00032
Further Details:      
 
Domain Number 3 Region: 62-154
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-20
Family I set domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000044602
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00209
Family Frizzled cysteine-rich domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044602   Gene: ENSRNOG00000029449   Transcript: ENSRNOT00000045987
Sequence length 937
Comment pep:known chromosome:Rnor_5.0:5:122797878:123141864:1 gene:ENSRNOG00000029449 transcript:ENSRNOT00000045987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRPRRRGTRPPPLALLAALLLAARGAAAQETELSVSAELVPTSSWNTSSEIDKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPNIRWFKNDAPVVQEPRRISFRATNYGSRLRIRN
LDTTDTGYFQCVATSGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEVLENVLCHTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAF
LFFFICVCRNNQKSPSPPVQRQPKPVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECTFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSSLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRFPNYMFPSQGIPPQGQIAGFIGPAIPQNQRFIPINGYPIPPGYAAFPAAHYQPAG
PPRVIQHCPPPKSRSPSSASGSTSTGHVASLPSSGSNQEANVPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDSKQPSLLGDSNIHGHTESMISAEV
Download sequence
Identical sequences ENSRNOP00000044602 10116.ENSRNOP00000044602 ENSRNOP00000044602 NP_001102141.1.100692 NP_001102141.1.4139 NYSGRC-IgSF-ENSRNOP00000044602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]