SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045261 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000045261
Domain Number 1 Region: 25-506
Classification Level Classification E-value
Superfamily ALDH-like 3.4e-172
Family ALDH-like 0.00000000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045261   Gene: ENSRNOG00000013028   Transcript: ENSRNOT00000043019
Sequence length 512
Comment pep:known chromosome:Rnor_5.0:1:128382914:128415160:-1 gene:ENSRNOG00000013028 transcript:ENSRNOT00000043019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTNGAVENGQPDGKPPALPRPIRNLEVKFTKIFINNDWHESKSGRKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGQLLHQLADLIERDRAILATLETM
DTGKPFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVMCFTRHEPIGVCGAITPW
NFPLLMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGRNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRPVGDPFDAKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVTDNMRIAKEEVCGPVQQFL
VLKGLSPSVKVQSSDVYALLXAVFTKNLDKALKLASALESGTVWVNCYNAFYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLDEKNP
Download sequence
Identical sequences 10116.ENSRNOP00000045261 ENSRNOP00000045261 ENSRNOP00000045261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]