SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045891 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000045891
Domain Number 1 Region: 296-553
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.25e-78
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 172-279
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-32
Family Kringle modules 0.00042
Further Details:      
 
Domain Number 3 Region: 72-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 111-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000911
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045891   Gene: ENSRNOG00000016659   Transcript: ENSRNOT00000044183
Sequence length 558
Comment pep:known chromosome:Rnor_5.0:1:284451955:284486016:1 gene:ENSRNOG00000016659 transcript:ENSRNOT00000044183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVMLVFRVLLLIALVGNSAIGLSLMPFIAPPDPDWTPDDYYYSYEQSSPDKDASVTQT
SPENPDWYYEDDDPCQSNPCEHGGDCIIRGNTFSCSCPAPFSGSRCQTVQNKCKDNPCVQ
GDCLITQTPPYYRCACKYPYTGPDCSKVLPVCRPNPCQNGGVCSRHRRRSRFSCACPDQY
KGRFCEIGPDDCYVGDGYSYRGKVSRTVNQNPCLYWNSHLLLQENYNMFMEDAETHGIAD
HNFCRNPDGDHKPWCFVKVNSEKVKWEYCNVEVCPESDAANPLGSLQEPVMELPGFDSCG
KTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGSLIHPCWVLTAAH
CTDMSTKHLKVVLGDQDLKKTESHEQTFRVEKILKYSQYNERDEIPHNDIALLKLKPVGG
HCALESKYVKTVCLPSDPFPSGTECHISGWGVTETGEGSRQLLDAKVKLIANALCNSRQL
YDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCEKDGTYYVYGIVSWGQECGKKPGVYTQ
VTKFLNWIKTTMHKEAGL
Download sequence
Identical sequences F1M8H8
ENSRNOP00000045891 ENSRNOP00000045891 10116.ENSRNOP00000045891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]