SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048216 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048216
Domain Number 1 Region: 2-382
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.74e-67
Family L-arabinose binding protein-like 0.0046
Further Details:      
 
Domain Number 2 Region: 403-516,635-774
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-63
Family Phosphate binding protein-like 0.00000000294
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000048216
Domain Number - Region: 538-630
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000863
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048216   Gene: ENSRNOG00000008992   Transcript: ENSRNOT00000045513
Sequence length 879
Comment pep:known chromosome:Rnor_5.0:5:147265647:147480507:1 gene:ENSRNOG00000008992 transcript:ENSRNOT00000045513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHVIRIGGIFEYADGPNAQVMNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDS
FEATKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVN
LYPDYASLSHAILDLVQSLKWRSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDS
DDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTTLDLYALDLEP
YRYSGVNLTGFRILNVDNPHVSAIVEKWSMERLQAAPRAESGLLDGVMMTDAALLYDAVH
IVSVCYQRAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDFD
LDIISLKEDGLEKVGVWSPADGLNITEVAKGRGPNVTDSLTNRSLIVTTLLEEPFVMFRK
SDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELIDHK
ADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLL
AYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPK
ALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGA
TMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYITQRNC
NLTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMKEKWWRGSGCPEEENK
EASALGIQKIGGIFIVLAAGLVLSVLVAVGEFIYKLRKTAEREQVRPWRRLRWTGKEALF
LQHSGRRDPLLPHLPAASQAQATASYDGQDRCGYQHAHL
Download sequence
Identical sequences ENSRNOP00000048216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]