SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048259 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048259
Domain Number 1 Region: 347-449
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.4e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 158-212,239-254,282-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000154
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 76-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 570-730
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000004
Family Tetraviridae-like VP 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048259   Gene: ENSRNOG00000031174   Transcript: ENSRNOT00000044738
Sequence length 785
Comment pep:known chromosome:Rnor_5.0:2:216092641:216149878:1 gene:ENSRNOG00000031174 transcript:ENSRNOT00000044738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATTANPEMTSDVPSLGPTIASGNPGPGIQGGGAVVQRAIKRRSGLDFDDEGEVNSKFL
RCDDEQMCNDKERFARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMA
VSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTP
VLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRM
CMGSRRSFICRMRCGTSSVDPVSMNRLSFLRNRCRNGLGSVKEGEPHFVVVHCTGYIKAW
PPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNICQPTEFISRHNIEGIFTF
VDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRAKNRE
WLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRSQLGPTTNLSLEMG
TGQLASRQQQQQQQQQQQQQQQQTELDMVPGRDGLASYSHSQVSVQPVATAGSEHSKPLE
KSEGLFVQDRDPRFSEIYPNISADQSKGLSSSTVPATQQLFSQGSSFPPNPRPAENFRNS
GLTPPVTIVQPSSSAGQILAQISRHSNLTQGSAPTWTSSTRPGFSAQLPTQATAKTRSSQ
FGVNNFQTSSSFSAMSLPGAPTASPSTAAYPTLPNRGSNFPPETGQTTGQFQTRTAEGVG
VWPQWQGQQPHHRSSSNEQHVQPTSAQPSSQPEVFQEMLSMLGDQSNTYNNEEFPDLTMF
PPFSE
Download sequence
Identical sequences E9PTS2
ENSRNOP00000048259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]