SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048806 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048806
Domain Number 1 Region: 354-695
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.37e-131
Family Transferrin 0.000000000315
Further Details:      
 
Domain Number 2 Region: 24-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.2e-112
Family Transferrin 0.00000000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048806   Gene: ENSRNOG00000031779   Transcript: ENSRNOT00000047752
Sequence length 709
Comment pep:known chromosome:Rnor_5.0:8:118632730:118655575:1 gene:ENSRNOG00000031779 transcript:ENSRNOT00000047752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPFITVLMFLGVLGPFLARIDTVVRWCTISRNEAQKCFMWQEMLNKAGVPKLRCARKYF
MPHCIQEIMMRRADAMTLSGSAIFDFYFPYKLQPIAAEVYGTKEKPRIHYYAVAVVKNSS
DIRLNQLQGLKSCHAGFDTSAGWIAPLGALRPYLNWDEKSVSLEEAVSKFFSQSCVPGIS
KSRFPRLCSLCAGKGEHICDFSPQEPYAGYAGAFRCLRDNAGDVAFIRESTIFEELPNEA
EWDQYKLLCPDNTWKPVTEYKECHLAQIPSRAVVAHVRSEKDSAIWELLHLSQEMFGKNK
TSKFELFGSYLGQKDLLFKDSVIGFVRVPFTVNVWLYLTFSYIMALKSLKESKENVMALR
ARITWCAVGSEEKLKCDQWSRVSVGKITCISCTTTEQCIFSITMGDADAMNLDGGYIYSA
GKCGLVPVLAEIQKSPNSNGSDCVDRPAEGYLAVAAVRKEDTGFTWSTVRGKKSCHTAVD
RTAGWNIPMGLLVNQTNSCQFKEFFNKSCAPGSFLYSNLCALCIGDENGKDKCNPNSQER
YQGYVGAFRCLAEKAGNVAFLKDATVLQNTDGKNADKWAKNLKLDDFELLCLDDTRKPVT
EAKNCHLAVAPNHAVVARKDKARLVQQELLYQQVQFGRNGCRCPEEFCLFRSETKNLLFN
DNTECLAKLPSKITWEEYLGKEYVVAIAHLRQCSNITQEAYNFLALRNS
Download sequence
Identical sequences D3ZAB1
ENSRNOP00000048806 ENSRNOP00000048806 10116.ENSRNOP00000048806 NP_001100334.1.100692 NP_001100334.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]