SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052010 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052010
Domain Number 1 Region: 377-506
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-41
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 234-365
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-37
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 3 Region: 827-952
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-33
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 4 Region: 516-652
Classification Level Classification E-value
Superfamily C-type lectin-like 5.33e-33
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 965-1116
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-32
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 6 Region: 662-812
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-30
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 7 Region: 1253-1394
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 8 Region: 1125-1251
Classification Level Classification E-value
Superfamily C-type lectin-like 3.26e-25
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 9 Region: 40-171
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.7e-23
Family Cysteine rich domain 0.0024
Further Details:      
 
Domain Number 10 Region: 171-229
Classification Level Classification E-value
Superfamily Kringle-like 2.28e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052010   Gene: ENSRNOG00000006548   Transcript: ENSRNOT00000055137
Sequence length 1480
Comment pep:known chromosome:Rnor_5.0:10:93278918:93339315:1 gene:ENSRNOG00000006548 transcript:ENSRNOT00000055137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPIRPALAPWPRHLLRCVLLLGGLRLGHPADSAAALLEPDVFLIFSQGMQGCLEAQGVQ
VRVIPVCNASLPAQRWKWVSRNRLFNLGAMQCLGTGWPATNTTVSLGMYECDREALSLRW
QCRTLGDQLSLLLGARANNASKPGTLERGDQTRSGHWNIYGSEEDLCARPYYEVYTIQGN
SHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDK
DQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGLN
DLDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDCSIALPYVCKK
KPNATAEPIQPDRWANVKVECDPSWQPFQGHCYRLQAEKRSWQESKRACLRGGGDLLSIH
SMTELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDC
VTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGTAEEDHGCRKGWTWHSPSCYWLGEDQVI
YSDARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDEV
MYTHWNRDQPGYRRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPDP
TPSLTGSCPQGWVSDPKLRHCYKVFSSERLQEKKSWIEALGVCRELGAQLLSLASYEEEH
FVANMLNKIFGESEPENHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSQHDDDN
IRGCAVLDLASLQWVAMQCQTQLDWICKIPRGVDVREPDIGRQGRLEWVRFQEAEYKFFE
HHSSWAQAQRICTWFQAELTSVHSQAELDFLGQNMQKLSSDQEQHWWIGLHTSESDGRFR
WSDGSVINFVSWAPGKPRPIGKDKKCVYMTARQEDWGDQRCHTALPYICKRSNSSGETRP
HDLPPSTLGGCPSGWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQA
YITASLPNVTFDLWIGLHGSQRDFQWIEQEPLLYTNWAPGEPSGPSPAPSGTKPTSCAVI
LHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAAALPAPGTELSYLNRTFRLLQ
KPLRWKDALLLCESRNASLAHVPDPYTQAFLTQAARGLQAPLWIGLASEEGSRRYSWLSE
EPLNYASWQDGEPQHTGGCAYVDVDGTWRTTSCDTKLQGAVCGVSRGPPPPRISYRGSCP
QGLADSSWIPFREHCYSFHTELLLGHKEALQRCQRAGGTVLSILDEMENVFVWEHLQTAE
TQSRGAWLGMNFNPKGGMLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPG
ACTNVTMGVVCKLPRVEENGFLPTAALPENPVALVVVLTAAVLLLLALLTGALILYRRRQ
SAERGSFEGARYSRSSRSGPAEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences ENSRNOP00000052010 ENSRNOP00000052010 10116.ENSRNOP00000052010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]