SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052203 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052203
Domain Number 1 Region: 398-475
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.5e-19
Family Intermediate filament protein, coiled coil region 0.00067
Further Details:      
 
Domain Number 2 Region: 166-200
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000288
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000052203
Domain Number - Region: 209-276
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000141
Family Intermediate filament protein, coiled coil region 0.011
Further Details:      
 
Domain Number - Region: 376-408
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0484
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052203   Gene: ENSRNOG00000036865   Transcript: ENSRNOT00000055336
Sequence length 519
Comment pep:known chromosome:Rnor_5.0:7:141259822:141271225:-1 gene:ENSRNOG00000036865 transcript:ENSRNOT00000055336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFSSQSAFSSRSRRVYSTRSSSGFGGGRQILVSVGQSRRCGGDYGGGFSSRSLYSLG
GSKSIFGGLVGRSASGFCQSRGAGGGFGGGFGGGRSFGGGGFGGGYGGGGRFGGGFGGGF
GTSNFGLGGFGPSYPPGGIHEVTVNQSLLEPLHLEVDPEIQKIKTQEREQIKTLNNKFAS
FIDKVRFLEQQNQVLQTKWELLQQVNTSTRTSSLEPIFEEFINQLQRQVDVLTNEQLRQN
SEIRSMQDIVEDYKNKYEDEINKRTNSENDFVVLKKDVDAAFMAKSDLQSRVDTLYGEIN
FLKYLFDTELSQIQTHVSDTNVILSMDNNRSLDLDSIINAVRTQYELIAQKSKDEAEALY
QTKYQELQITAGKHGDDLKNSKMEISELNRNAQRLQAEIANIKKQIEQMHGSISDAEERG
ERALQDAKQKLQETEEALQQMKEDLARLLRDYQALLGAKLSLDVEIATYRELLEGEESRM
SGALQSQVSIWALPSNEGNDLGERLHDPQSQVPVPKLGC
Download sequence
Identical sequences Q6IG01
NP_001008807.1.100692 NP_001008807.1.4139 ENSRNOP00000052203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]