SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052338 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052338
Domain Number 1 Region: 303-403
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.59e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 48-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000114
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000052338
Domain Number - Region: 132-178,205-250
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00269
Family BphP N-terminal domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052338   Gene: ENSRNOG00000001830   Transcript: ENSRNOT00000055473
Sequence length 568
Comment pep:novel chromosome:Rnor_5.0:4:245261269:245310513:1 gene:ENSRNOG00000001830 transcript:ENSRNOT00000055473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPRKRRRSDSELLQSEFRTDAMVENLPRSPFTSVLSTRTGVAVPNGIREAHSQTEKRR
RDKMNHLIWKLSSMIPPHIPTAHKLDKLSILRRAVQYLRSQRGMTEFYLGENAKPSFIQD
KELSHLILKAAEGFLLVVGCEGGRILFVSKSVSKTLHYDQVSSCCPGFSPQLRKKEKEKR
EREREREGKKTSPQVHSHSHIGRSRVHSGSRRSFFFRMKSSCTVPVKEEQRCSSCSKKKD
QRKFHTIHCTGYLRSWPPNVVGTEKEMGSGKDSGPLTCLVAMGRLQPYTVPPKNGKINVR
PAEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLSDKHKAVLQSK
EKILTDSYKFRVKDGSFVTLKSKWFSFTNPWTKKLEYIVSVNTLVLGRSETAVSVPQCRS
SQSSEVHEQHACVFSTPGSKISALLRSLEINIACLPLFRSHSSSPEDANPSGVVRDKHSV
NFGSAPVPVSTGELFALSPETEGLEAARQHQSAEPAHCHKPLLSDSTQLGFDALCDSDDT
AMATFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences ENSRNOP00000052338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]