SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052371 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052371
Domain Number 1 Region: 60-128
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000224
Family TNF receptor-like 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000052371
Domain Number - Region: 135-158
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00283
Family TNF receptor-like 0.0033
Further Details:      
 
Domain Number - Region: 24-55
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0471
Family TNF receptor-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052371   Gene: ENSRNOG00000036942   Transcript: ENSRNOT00000055506
Sequence length 258
Comment pep:known chromosome:Rnor_5.0:5:171587145:171613565:1 gene:ENSRNOG00000036942 transcript:ENSRNOT00000055506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSCYNMVVTVLLVVGTEEVRATRNPCDSCEAGTFCSKYPPVCTSCPPSTYSSTGGQPN
CDICRVCQGYFRFKKPCSSTHNAECECVEGFHCLGPKCTRCEKDCRPGQELTEQGCKNCG
LGTFNDQDGAGVCRPWTNCSLDGRSVLKNGTKEKDVVCGPPVVSLSPSTTPSAVTTPERE
SGERPLQVLTLFLALTLALLLFLIFIILWFSVPKWLRKKFPHIFKQPFKKAVRTAQEEDA
CSCRFPEEEEGGGGSYEL
Download sequence
Identical sequences Q4V895
ENSRNOP00000052371 NP_001020944.1.100692 NP_001020944.1.4139 XP_006239533.1.100692 XP_006239534.1.100692 XP_008762504.1.100692 XP_008762505.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]