SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052583 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052583
Domain Number 1 Region: 232-537
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.41e-79
Family FMN-linked oxidoreductases 0.0000000000326
Further Details:      
 
Domain Number 2 Region: 551-710
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.37e-29
Family Ferredoxin domains from multidomain proteins 0.000000382
Further Details:      
 
Domain Number 3 Region: 19-111
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000332
Family C-terminal domain of adrenodoxin reductase-like 0.000025
Further Details:      
 
Domain Number 4 Region: 34-67,136-204
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000161
Family C-terminal domain of adrenodoxin reductase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052583   Gene: ENSRNOG00000017105   Transcript: ENSRNOT00000055723
Sequence length 723
Comment pep:known_by_projection chromosome:Rnor_5.0:2:240215937:240744042:1 gene:ENSRNOG00000017105 transcript:ENSRNOT00000055723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLPEPKKDHIFQGLTQVQGFYTSKDFLPLVAKGSKPGMCACHSPLPSVRGAVIVLGAGD
TAFDCATSALRCGARRVFIVFRKGFANIRAVPEEVNVLISLKCILISFCQITVKGNLLKD
EESHVVVRLSIVLPNVGSRIDSRVMIEALSPIKFNRWGLPEVNPETMQTSEPWVFAGGDV
VGMANTTVESVNDGKQASWYIHKYIQAQYGALVPSQPTLPLFYTPVDLVDISVEMAGLRF
PNPFGLASATPATSTPMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPLYGP
GQSSFLNIELISEKTAAYWCHSVTELKADFPDNILIASIMCSYNKNDWMELSKMAEASGA
DALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQSVRVPFFAKLTPNVTDIVSIAR
AAKEGGADGVTATNTVSGLMGLKADGSPWPSVGSGKRTTYGGVSGTAIRPIALRAVTAIA
RALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYLKS
IEELSDWDGQSPPTMSHQKGKPVPHIAELMGQKLPSFGPYLERRKKILAASKIREKDQNR
ACSPLQRKHFNSQKPIPAIKDVIGKSLQYLGTFGELNVMEQVVALIDEEMCINCGKCYMT
CNDSGYQAIQFDPETHLPTVSDTCTGCTLCLSVCPIMDCIRMVSRATPYEPKRGLPLAVK
PVC
Download sequence
Identical sequences ENSRNOP00000052583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]