SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052647 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052647
Domain Number 1 Region: 3435-3602
Classification Level Classification E-value
Superfamily SPOC domain-like 7.45e-64
Family SPOC domain 0.0000000225
Further Details:      
 
Domain Number 2 Region: 409-563
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.84e-31
Family Canonical RBD 0.0032
Further Details:      
 
Domain Number 3 Region: 1-64,305-388
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000587
Family Canonical RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052647   Gene: ENSRNOG00000033556   Transcript: ENSRNOT00000055791
Sequence length 3603
Comment pep:known chromosome:Rnor_5.0:5:163736425:163790133:-1 gene:ENSRNOG00000033556 transcript:ENSRNOT00000055791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIPSA
ARGLDDTVSIASRSREVSGFRGSGGGPAYGPPPSLHAREGRYERRLDGASDNRERAYEHS
AYGHHERGTGAFDRTRHYDQDYYRDPRERTLQHGLYYTSRSRSPNRFDAHDPRYEPRARE
QFTLPSVVHRDIYRDDLTREVRGRRPERNYQHSRSRSPHSSQSRNQSPQRLASQASRPTR
SPSGSGSRSRSSSSDSISSSSSSSTDSSDSSSTSSDDSPARSVQSAAVPAPTSQLLSSLE
KDEPRKSFGIKVQNLPVRSTDTSLKDGLFHEFKKFGKVTSVQIHGASEERYGLVFFRQQE
DQEKALTASKGKLFFGMQIEVTAWVGPETESENEFRPLDERIDEFHPKATRTLFIGNLEK
TTTYHDLRNIFQRFGEIVDIDIKKVNGVPQYAFLQYCDIASVCKAIKKMDGEYLGNNRLK
LGFGKSMPTNCVWLDGLSSNVSDQYLTRHFCRYGPVVKVVFDRLKGLALVLYSEIEYAQA
AVRETKGRKIGGNKIKVDFANRESQLAFYHCMEKSGQDMRDFYEMLTERRAMQKRKSKLH
RMFSAPAPSPRFVREERRGSYDYSQDRTYYENVRTPGAYPEDSRRDYPARGRELYSEWET
YQGEYYESRYYDDPREYREYRSDPYEQDIREYSYRQRERERERERFESDRDHERRPIERS
QSPVHLRRPQSPGVSPAHSERLPSDSERRLYRRSSERSGSCSSVSPPRYDKLEKARLERY
TKNEKTDKERIFDAERVERERRVIRKEKVEKDKPERQKRKGKVHSPSSQSSETEQENDRD
QSPEKPRASTKLSRDRTDKEGPAKNRLELVPCVVLTRVKEKEGKVIDHPPPEKLKARLAH
DTAKSSVLDQKSQASQVEPPKVDAARGKALREKAFSSHAEVVDKEGRPKLRKHLKPEQAP
ELSALDLEKLEARKRRFADSSLKVEKPRPEVRKTSPEAEDTRALLKKQPDTPRDGILLRE
GESERKPVRKEILKRESKKTKLERLNSTLSPKDCQEPAAVSAGSGSRPSSDVHAALGEPV
HGSVETQEAQPKKVMPSKPRLKQLQLLDSQGPEKEEVRKNYCRLREDPVEHKAGQEKPHG
VNAEEKLGIDIDHTQSYRKQMEQSRRKQQMEMEIAKSEKFGSPKKDVDEYERRSLVHEVG
KPPQDVTDDSPPSKKRRTDHVDFDICTKRERNYRSSRQISEDSERTSCSPGVHHGSFHED
DDPIGSPRLMSVKGSPRVDDKGLPYSNVAVREDPFRCTPYDSGKREQAADMAKIKLSVLS
SEGEPNRWDPQMKQDPSRFDVSFPNSIIKRDSLRKRCVRDLEPGEVPSDSDEDAEHRAQS
PRASSFYDSPRLSFLLRDRDHKLRDRDDRLSSSLERNKFYSFALDKTITPDTKALLERAK
SLSSSREENWSFLDWGSRFANFRDNKDKEKVDSAPRPIPSWYMKKKKIRTDSEGKLDDKK
DEHREEEQERQELFASRFLHSSIFEQDSRRLQHLERKSEESDFPPGRLYGRQASEGANST
SDSVQEPVVLFHSRFMELTRMQQKEKEKDQKPKETEKQEGPETPKTPEPTTETKEPEPKA
PVSVALPAITAVTPEPPPPAAAAEKAEETSEAPSLAGERPEEPTPVLEETKLVSEPPSES
VEQRKQVDLSPGKDSHDSTAVVASTPPESTTTDTVPCVDAEPLTPGTTVSQVESSADPKP
SSPQPPSKLTQRCEEAEEPKVERPETTASIEPDATEKAEVVPEVQPPASEDVEASPPVTA
KDRKTTKSKRSKTSVPAAAASIVEKPVTRKSERIDREKMKRSSSPRGEAQKLLELKMEAD
KVTRTASKSSGGDTEHPEPSLPLSRTRRRNVRSVYATMGDHESRSPAKEPTEQPRVTRKR
LERELQEAVVVPATPRRGRPPKTRRRVEEGGEQERKEPADTPRPAEGRRSPRSQKLAATG
GPQGKRGRNEHRAEAAEATAQVSAREGNAKARGDREAASETRRDRKDPSTDKDGPDIFPV
EVERKPPEKTYKSKRGRARSTRSGMDRAAHLKSLEMARQAADKEAEPVAASPEKNESPLE
GSGVSPQLADNPADPDKEAEKESVSASTVSPEARQLTKQMELQQAVENIAKLAEPSAAAA
DKGTATATSEEPAAEDGHKPAHQASETELAAAIGSIISDSSGEPENFSASPSVPPGSQTH
LQEGMEPGPHEATPGILETEAATESSAQQASASDPPAGSADTKEARGNSSDSVQQAKEAK
VAVTPPRKDKGRQKTTRSRRKRNVNKKVAAATETRASEAEQPQSESPAAAAAAAAAPEEP
QEEKQSEKPHSPLRECTSDPSKTPPAESLSQENSVEEKTPCKTPAPPDLPPLSQPALVDD
EPQARFKVHSIIESDPVTPPSDSSIPPPTIPLVTIAKLPPPVIPGGVPHQSPPPKVTEWI
TRQEEPRAQSAPSPALPPDTKASDVDTSSSTLRKILMDPKYVSATGVTSTSVTAAIAEPV
SAPRLQEAPAPPCEPKRPSSEEKVAAAVPHADTQASEVPVAADKEKVAPVIAPKITSVIS
RMPVSIDLENSQKITLAKPAPQTLTGLVSALTGLVNVSLVPVNALKGPVKGSVATLKGLV
STPAGPVNLLKGPVNVLTGPVNVLTTPVSATVGTVSAAPGTVTAACGVTATTGTAAMSGA
VPAPAAKGKQRSSSNENSRFHPGSMSVIDDRPADTGSGAGLRVNTSEGVVLLSYSGQKTE
GPQRISAKISQIPPASAMDIEFQQSVSKSQVKADSVTPTQAAPKGPQTPSAFANVAAHST
LVLTAQTYNASPVISSVKTDRPSLEKPEPIHLSVSTPVTQGGTVKVLTQGINTPPVLVHN
QLVLTPSIVTTNKKLADPVTLKIETKVLQPANLGPTLTPHHPPALPSKLPAEVNHVPSGP
SNPADRTIAHLATTKPDTHSPRPTGPTPGPFPRACHPSSTTSTALSTNATVMLAAGIPVP
QFISSIHPEQSVIMPPHSITQTVSLGHLSQGEVRMSTPTLPSITYSIRPETLHSPRAPLQ
PQQIEARAPQRVSTPQPATTAVPALATQHPPEEEVHYHLPVARAAAPVQSEVLVMQSEYR
LHPYTVPRDVRIMVHPHVTAVSEQPRATEGVVKVPPASKAPQQLVKEVVKTSDAKAVPAP
APVPVPVPVPTPAPPPHGEARILTVTPSSQLQGLPLTPPVVVTHGVQIVHSSGELFQEYR
YGDIRTYHAPAQLTHTQFPVASSINLPSRTKTSAQGPPESEPLQSTQPAQPAPSTQSTQP
VPPAPPCQPSQLSQPAQPPSGKIPQVSQEAKGTQTGGIEQTRLPAMPTNRPSEPHAQAQR
APGETPQPAHPSPVSVAMKPDLPTPLASQAAPKQPLFVPVNSGTSTPPGLALPHAEAQPA
PKQDSAPHGTPQRPVDMVQLLKKYPIVWQGLLALKNDTAAVQLHFVSGNNVLAHRSLPLS
EGGPPLRIAQRMRLEASQLEGVARRMTVETDYCLLLALPCGRDQEDVVSQTESLKAAFIT
YLQAKQAAGIINVPNPGSNQPAYVLQIFPPCEFSESHLSRLAPDLLASISNISPHLMIVI
ASV
Download sequence
Identical sequences ENSRNOP00000052647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]