SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053035 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053035
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-121
Family Transglutaminase core 0.0000000112
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily E set domains 3.08e-43
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 607-704
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.7e-25
Family Transglutaminase, two C-terminal domains 0.00055
Further Details:      
 
Domain Number 4 Region: 486-604
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.02e-24
Family Transglutaminase, two C-terminal domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053035   Gene: ENSRNOG00000037203   Transcript: ENSRNOT00000056190
Sequence length 709
Comment pep:known_by_projection chromosome:Rnor_5.0:3:119581674:119597688:-1 gene:ENSRNOG00000037203 transcript:ENSRNOT00000056190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVAALELRSVELQIPRNNKDHHTQDLGSSKLILRRGQIFILTIVFSRPFQPQKDHLTFV
AETGPEPTELLGTRATFFLVQTRPENVWSASDFVIDSNSLQVSIFSPASAVIGHYTLKLE
ISRDQGPGVTYPLGNFILLFNPWSTEDDVYLPSEALLREYIMCDYGFVYKGQANSITSRP
WNYGQFEEDIVDICFEILNKSLYFLKNPSKDHSQRNDVVYVCRVVSAMINSNDDSGVLQG
NWGEDYSQGTSPLEWNGSVAILRQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVVS
NFHSAHNTDGNLTIDTYYDRTAEMLPAQRPDKIWNFHVWNECWMIRKDLPPGYNGWQVLD
PTPQQTSSGLFCCGPASVKAIKEGDVQLPYDTPFVYAEVNADEVVWLFEGGQVQEILAHN
ISYIGKAISTKMVGSDERLDITSSYKYPEGSSEERSVFIKASWKLLEPRRNSSSLLDLLG
SENFKDKPVQLQLHLARAPMWGQDVLLMLLVRRVPVRDHVQGPVGLTVRFCAQALLHGGG
TRKPFWRHVVHLNVDSEKELQWPLLLPYSNYRDKLTDENLIHVSGIAEVEETGQFILVLK
EFSLEPPYLSIEVFEKAEVGKALNIHITLTNTLMVPLNNCTMVLEGSGLINGQMTKDLGT
LMAGHTIRIQLELYPIKAGRHQLQVLISSSEVKEIKGYKDIFIAAAPAS
Download sequence
Identical sequences F1LZP5
ENSRNOP00000053035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]