SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053129 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000053129
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00706
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053129   Gene: ENSRNOG00000023816   Transcript: ENSRNOT00000056289
Sequence length 247
Comment pep:known chromosome:Rnor_5.0:2:217496482:217499990:1 gene:ENSRNOG00000023816 transcript:ENSRNOT00000056289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFVTAGGSLRSIQ
RSLSCKD
Download sequence
Identical sequences Q5PQQ3
NP_001014277.1.100692 NP_001014277.1.4139 ENSRNOP00000053129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]