SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053231 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053231
Domain Number 1 Region: 75-203
Classification Level Classification E-value
Superfamily Plus3-like 1.44e-46
Family Plus3 0.000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053231   Gene: ENSRNOG00000005183   Transcript: ENSRNOT00000056392
Sequence length 429
Comment pep:known chromosome:Rnor_5.0:3:118026883:118086227:1 gene:ENSRNOG00000005183 transcript:ENSRNOT00000056392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEDDDKSSEKSDRSSRTSSSDEEE
EKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYR
VAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFS
AGMQLPTLDEINKKEFSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKA
MAEDLGDQDKAKQIQDQLNELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVA
ESHNMRNQQMDPFTRRQCKPTIVSNSRDPAVQAAILAQLNAKYGSGALPDAPKEVSKGQG
KDKDLNSKSASDLSEDLFKVHDFDVKIDLQVPSSESKALAITSKAPPAKDGAPRRSLNLE
DYKKRRGLI
Download sequence
Identical sequences D3ZLH8
ENSRNOP00000053231 NP_001102428.1.100692 NP_001102428.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]