SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053319 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053319
Domain Number 1 Region: 119-461
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.06e-124
Family Transferrin 0.00000000302
Further Details:      
 
Domain Number 2 Region: 4-114
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.01e-33
Family Transferrin 0.00000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053319   Gene: ENSRNOG00000009434   Transcript: ENSRNOT00000056483
Sequence length 462
Comment pep:known chromosome:Rnor_5.0:8:111134566:111154326:-1 gene:ENSRNOG00000009434 transcript:ENSRNOT00000056483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKADRDQYELLCPDNTRRPVDEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEH
FGKDKSSTFQLFGSPHGKDLLFTDAACGLLRVPPKMDIGLYLGYELLSAIRNLKRGSEDS
RRVKWCAVGQQERAKCDHWSAVSGGALACATEETPEDCIAAVMKGEADAVNLDGGFAYIA
GHCGLVPGLGENYLSPHSSERLGSKCVNAALEGYYVVAVVKKSDVGITWNSLQGKKSCHT
AVGTSAGWNVPMSLIYNQTGSCKFGRTDSGLSFHADEFFSGGCAPGANPDSRLCALCAGG
NEPAHMCAANNDEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPESWAKGLKHEDF
ELLCLDGTRKPVTEAQNCHLDRVPNHAVFSRKDKVDFVQRMLFNQQELFGRNGFEYRMFQ
MFESSHKDLLFSDDTECLSNLQNKATYKTYLGPQYLTLMDNF
Download sequence
Identical sequences ENSRNOP00000053319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]