SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053848 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053848
Domain Number 1 Region: 304-497
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.2e-47
Family Sec63 N-terminal domain 0.0000655
Further Details:      
 
Domain Number 2 Region: 4-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-41
Family Tandem AAA-ATPase domain 0.00032
Further Details:      
 
Domain Number 3 Region: 534-644
Classification Level Classification E-value
Superfamily E set domains 5.46e-24
Family Sec63 C-terminal domain-like 0.00077
Further Details:      
 
Domain Number 4 Region: 185-287
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000258
Family RecQ helicase DNA-binding domain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053848   Gene: ENSRNOG00000037604   Transcript: ENSRNOT00000057016
Sequence length 663
Comment pep:known chromosome:Rnor_5.0:20:57025333:57156837:1 gene:ENSRNOG00000037604 transcript:ENSRNOT00000057016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASMNKPAFQAIRSHSPAKPVLIFVSSRRQTRLTALELIAFLATEEDPKQWLNMDEQEME
NIIATVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPA
HLVIIKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFL
YEPFPVESSLLGVLSDHLNAEIAGGTITSKQDALDYITWTYFFRRLIMNPSYYNLGDVSQ
DAINKFLSHLIGQSLVELELSHCIEVGEDNRSIEPLTCGRIASYYYLKHKTVKMFKDRLK
PECSTEELLSILSDAEEYTDLPVRHNEDHTNNELAKCLPIELNPHSFDSPHTKAHLLLQA
HLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAASQGWLVTTLNITHLIQMVIQGRWLK
DSSLLTIPNIEQHHLHLFRKWKPPVKGPHAKCRTSIECLPELIHACEGKEHVFSSMVEKE
LQPAKTKQAWNFLSHLPVINVGISVKGSWDDSVEGHNELSISTLTADKRDENTWIKLHAD
QQYVLQVSLQRVHFEFHKVKHESHAVTPRFPKLKDEGWFLILGEVDKRELVAVKRVGFVR
THHEASISFFTPEAPGRYIFTLYLMSDCYLGLDQQYDIFLNVTKADISTQINTEVPDVST
DLA
Download sequence
Identical sequences B5DFL2
ENSRNOP00000053848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]