SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053964 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053964
Domain Number 1 Region: 360-461
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.91e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053964   Gene: ENSRNOG00000007387   Transcript: ENSRNOT00000057136
Sequence length 1293
Comment pep:known chromosome:Rnor_5.0:10:55430184:55439080:1 gene:ENSRNOG00000007387 transcript:ENSRNOT00000057136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPLEGADGGGDPRPGEPFCPGGVPSPGAPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCAMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAGV
LLRCKRDVFRGARFSELLAPQDVGVFYGSTTPSRLPTWGTGTSAGSGLKDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPVPSPAP
SLDSDIQELSEQIHRLLLQPVHSSSTTGLCGVGPLMSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRAKPPPRPRLLATGTFKAKVLPCQSPNPELEVA
PAPDQASLALAPEEPERKESSGCSYQQINCLDSILRYLESCNIPNTTKRKCASSSCTASS
ASDDDKQRAGPVPVGAKKDTSSAVLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTSQ
CSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTKA
VLSLHTQKEEQAFLSRFRDLGRLRGLDTSSVAPSAPGCHHGPIPSGRRHHCRSKAKRSRH
HQTPRPETPCYVSHPSPVPSSGPWPPPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPTS
VSPATFPSPLVTPMVALVLPNYLFPSPTSYPYGVSQAPVEGPPTPASHSPSPSLPPPPPS
PPHRPDSPLFNSRCSSPLQLNLLQLEESPRTEGGAAAGGPGSSAGPLPPSEESAEPEPRL
VEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSAS
ITRSSQSSHTSKYFGSIDSSEAEAGAAQARTEPGDQVIKYVLQDPIWLLMANADQHVMMT
YQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPQALDVTACVD
CGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGVGGGGGGVGGGGGDGGEEAQTQIG
TKGSSSQDSAMEEEEQGGSSSSPALPAEENGTS
Download sequence
Identical sequences Q8CHI5
NP_001029297.1.100692 NP_001029297.1.4139 XP_006246675.1.100692 XP_006246676.1.100692 ENSRNOP00000009674 ENSRNOP00000053964 10116.ENSRNOP00000053964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]