SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053974 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053974
Domain Number 1 Region: 325-439
Classification Level Classification E-value
Superfamily Anthrax protective antigen 5.62e-19
Family Anthrax protective antigen 0.015
Further Details:      
 
Domain Number 2 Region: 232-321
Classification Level Classification E-value
Superfamily E set domains 0.00000000000904
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 3 Region: 31-123
Classification Level Classification E-value
Superfamily E set domains 0.00000000204
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 4 Region: 142-192
Classification Level Classification E-value
Superfamily E set domains 0.000000714
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053974   Gene: ENSRNOG00000004398   Transcript: ENSRNOT00000057146
Sequence length 747
Comment pep:novel chromosome:Rnor_5.0:7:83387129:83442468:1 gene:ENSRNOG00000004398 transcript:ENSRNOT00000057146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHLWLSTWFLFGLLWCAADSHTGTSETVPKVTEVIPKYGSINGATRLTIKGEGFSQASQ
FNYGADNIELGNHVQLVSSFQSITCDVEKDSTHSTQITCYTRAMPEDVYSVRVSVDGVPV
AENNTCKGVVSSWACSFSTKRFRTPTIRSITPLSGTPGTLITIQGRLFTDVYGSNTALSS
NGRNVRILRTYIGGMPCELLIPHSDDLSFPENTTYFVSSLNKISMFQTYAEVAMVSPSKG
SPEGGTILTIHGQFFDQTDLPVRVLVGGQACDILNVTENTIYCKTPPKPHVLKATYPGGR
GLKIEVWNNSRPTHLEDILEYSEQTPGYMGASWTDSASYVWPIEQDTFVARISGFLVPPD
SDVYRFYIRGDDRYAIYFSQTGHPEDKVRIAYYSRNANTYFSSSTQKSDEIHLQKGKEYY
IEILLQEYTLSAFVDVGLYQYKSVFTEQQTGDALNEEQVIKSQSTVIPEVQIITLENWET
ADAIKEVQQVTVTSPCVGANSCSLSQYRFIYNMEKTVWLPADASAFMLQSALNDLWSIKP
DSVQVTSKRDLQSYIYTITFASTRGDFDLLGYEVFEGSNVTLNITEHTKGKPNLETFTLN
WDGIASKPLTPESSEAEFQEAVEEMVSAKCPPEIAHLEEGFLVKYFRDYETHFELEHNNR
AQKTAETDAFCGRYSLKNPAVLFDSTDVKPNKLPYGDILLFPYNQLCLAYKGSLANFIGL
KFKYEDSGKIIRSADMQFEYNFASGNK
Download sequence
Identical sequences ENSRNOP00000053974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]