SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Rattus norvegicus 76_5.0 > ENSRNOP00000054312

Domain assignment for ENSRNOP00000054312 from Rattus norvegicus 76_5.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSRNOP00000054312
Domain Number 1	Region: 145-260
Classification Level	Classification	E-value
Superfamily	Cystatin/monellin	1.87e-51
Family	Latexin-like	0.0002
Further Details:

Domain Number 2	Region: 46-141
Classification Level	Classification	E-value
Superfamily	Cystatin/monellin	1.7e-28
Family	Latexin-like	0.0081
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSRNOP00000054312 Gene: ENSRNOG00000037853 Transcript: ENSRNOT00000057504
Sequence length	284
Comment	pep:known chromosome:Rnor_5.0:2:184000125:184034599:-1 gene:ENSRNOG00000037853 transcript:ENSRNOT00000057504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPPSRPPPPALLLSLWLLPSLALAAAAAAPVKPEYTVVSGQPPAVGLPRGILQLAARAAL HFLNFRAGSPSALRVLAAVQEGRAWVDPQEGCEVDLVFSTEHYNPEQEGEERLGKCSARV FFKNEKPRPAVNVTCTRLFEKSKRQEKDYLLYKQMKQLKTRLDVVSIPDNQGHIDPSLRP LWDLAFLGSSYVMWEKTSQFLHYYLIQLSSVKQLKTDDDSIDFDFTVLLHEFSTQEIIPC RIHMVWYPGKPLKVNYHCQELQNPEETSGTAEASAMEPAEFSTF
Download sequence
Identical sequences	Q58NB7 NP_001014790.1.100692 NP_001014790.1.4139 ENSRNOP00000054312 10116.ENSRNOP00000054312 ENSRNOP00000054312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]