SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054550 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054550
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Kringle-like 2.08e-20
Family Kringle modules 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054550   Gene: ENSRNOG00000018859   Transcript: ENSRNOT00000057738
Sequence length 246
Comment pep:known chromosome:Rnor_5.0:14:84248813:84260745:1 gene:ENSRNOG00000018859 transcript:ENSRNOT00000057738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVHTFLLSNMLLAEAYGSGGCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSGESLA
QPSPGNHNYCRNPDQDPRGPWCYISSETGVPEKRPCEDLRCPVGVPGDKETQVFPPANAL
PARSEAAEVQPVIGISQRVRMNSKEKKDLGTLGYVLGVTMTVIIIAIGVGIVLGYTYKRG
KDLKEQHEQKVCEREMQRITLPLSAFTNPTCEIMDEKTIIVHSNQTPADVQEGSTLLTDQ
AGTPGA
Download sequence
Identical sequences ENSRNOP00000054550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]