SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054699 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054699
Domain Number 1 Region: 6-99
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000602
Family Ribosomal protein L14e 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054699   Gene: ENSRNOG00000038041   Transcript: ENSRNOT00000057891
Sequence length 137
Comment pep:novel chromosome:Rnor_5.0:15:86115132:86115542:-1 gene:ENSRNOG00000038041 transcript:ENSRNOT00000057891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKFKRPRKVVLVLAGQYSGCKAVILKIIDDGTSDRPYSHALVAGIDRYSRKVASAMGKK
KIAKRSKIKSFGKIYNYNFLMPTRYPMDIPLHKTVVNKDVCRDPALKYMARQEAEVKSEE
RHIGYGREEQMFFSRSF
Download sequence
Identical sequences D4A7W3
10116.ENSRNOP00000054699 ENSRNOP00000054699 ENSRNOP00000054699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]