SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055440 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055440
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.59e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000453
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.62e-26
Family Middle domain of MutM-like DNA repair proteins 0.00000258
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.71e-19
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055440   Gene: ENSRNOG00000018577   Transcript: ENSRNOT00000058645
Sequence length 387
Comment pep:known chromosome:Rnor_5.0:8:60387398:60393242:-1 gene:ENSRNOG00000018577 transcript:ENSRNOT00000058645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASHFVNEICKGLVFGGCVEKSSVSRNPEVPFESSAYHISALARGKELRLTL
SPLPGSHPPQKPLSLVFRFGMSGSFQLVPAEALPRHAHLRFYTAPPAPRLALCFVDIRRF
GHWDPGGEWQPGRGPCVLLEYERFRENVLRNLSDKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARTVLEALQQCRLSPELTLSQKVKAKLQNPDLLELCHLVPKEVVQLG
GKGYGPERGEEDFAAFRAWLRCYAVPGMSSLRDRHGRTIWFQGDPGPLAPKGGRSRKKKS
QETQLEAEDRKEDPPSKSISRTQRARKHCPKNVPQQSEGASLPQNLETPAVPEKGKRRGR
RASTGRHRGPKSKPDTQPREAGEISAS
Download sequence
Identical sequences Q4KLM0
NP_001020925.1.100692 NP_001020925.1.4139 ENSRNOP00000055440 10116.ENSRNOP00000055440 ENSRNOP00000055440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]