SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056394 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056394
Domain Number 1 Region: 629-929
Classification Level Classification E-value
Superfamily ALDH-like 9.03e-104
Family ALDH-like 0.0000000614
Further Details:      
 
Domain Number 2 Region: 440-567
Classification Level Classification E-value
Superfamily ALDH-like 3.37e-31
Family ALDH-like 0.0000656
Further Details:      
 
Domain Number 3 Region: 231-331
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.45e-25
Family Post formyltransferase domain 0.0000139
Further Details:      
 
Domain Number 4 Region: 23-227
Classification Level Classification E-value
Superfamily Formyltransferase 2.22e-21
Family Formyltransferase 0.00000134
Further Details:      
 
Domain Number 5 Region: 349-437
Classification Level Classification E-value
Superfamily ACP-like 0.00004
Family Acyl-carrier protein (ACP) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056394   Gene: ENSRNOG00000008586   Transcript: ENSRNOT00000059639
Sequence length 930
Comment pep:known_by_projection chromosome:Rnor_5.0:7:26506321:26555206:1 gene:ENSRNOG00000008586 transcript:ENSRNOT00000059639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWRGSQALRHFSTGRVYFKNKLKLALIGQSLFGQEVYSHLLKEGHRVVGVFTVPDKDGK
ADPLELVLWHRCTTEPPIYKTTTTKPKTKTKNYMWCSKILFGIERLMLGICLLLIWQPAT
FSPLVLSMIEYNVGRTGKDESDSALEGTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDV
KPNDTVDSLYNRFLFPEGIKAMVEAVQLIADGKAPRTPQPEEGATYEGIQKKENAEIPWD
QPAEVLHNWIRGHDKVPGAWAEIDGQMVTFYGSSLLTSSVPAGEPLDIRGAKKPGLVTKN
GLVLFGNDGKALMVRNLQFEDGKMIPASQYFSSGETSVVELTAEELKVAETIKVIWARIL
SNVPVIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMARKFGDFIQKVVRRL
RGEDQEAELVVDYVSKEVNEMTVKMPYQCFINGQFVDAEDGETYATINPTDGTTLCRVSY
ASLADVDRAVAAAKDAFENGEWGRMNARDRGRLMYRLADLMEENQEELATIEALDSGAVY
TLALKTHIGMSVQTFRYFAGWCDKIQEKGLKLTSNMADGNHILLWSPSLSRPTLMCMHLK
YAPYPQMSAFTVTKKGPGKDGDYCIHFQVTPLTALKFAELTVKAGFPKGVINIIPGSGGV
AGQRLSQHPDIRKLGFTGSTSVGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCELDKAV
RMGMGAVFFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHK
AHLEKLLQYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLAKEESFGPIMVI
SKFQNGDIDGVLQRANNTEYGLASGVFTRDISKAMYVSDRLEAGTVFINTYNKTDVAAPF
GGVKQSGFGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences ENSRNOP00000056394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]