SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056587 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000056587
Domain Number - Region: 179-251
Classification Level Classification E-value
Superfamily Integrin domains 0.0942
Family Integrin domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056587   Gene: ENSRNOG00000050598   Transcript: ENSRNOT00000059842
Sequence length 300
Comment pep:novel chromosome:Rnor_5.0:7:19738502:19739401:1 gene:ENSRNOG00000050598 transcript:ENSRNOT00000059842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDSEECVKCPEDWYADTEQTHCLPKAVTFLAYEDPLGMALVCLALCFSVLTALVLGVFLK
HRETPIVKANNRTLSYILLTALIFCFLCSLLFVGNPNTTTCILQQTTFGILFTVSVSTVL
AKTLTVVLAFRITLPGRRMRGLMVSRIPKYIIPICTVVQIILYGIWLWTSPPFVDIDTHS
EHGCITITCSKGSVMAFYCVLGYLGSLALVSFTVAFLARNLPDTFNEAKFLTFSMLVFCS
VWITFLPVYHSSKGKVMVAVEVFSILASSMGLLGCIFIPKCYIILLRPDRNSIQKFRDKT
Download sequence
Identical sequences ENSRNOP00000056587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]