SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056776 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056776
Domain Number 1 Region: 65-144
Classification Level Classification E-value
Superfamily E set domains 0.0000000035
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000056776
Domain Number - Region: 398-516
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.000842
Family Acetylhydrolase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056776   Gene: ENSRNOG00000039216   Transcript: ENSRNOT00000060025
Sequence length 519
Comment pep:novel chromosome:Rnor_5.0:12:21618196:21624512:1 gene:ENSRNOG00000039216 transcript:ENSRNOT00000060025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTWHEPIIRLLPPPHPVSEDVSETIDRDSVPQELFNLTSLVYWPPTGGDRDDFLASTSP
RTSTYHLKGPAQANYTLGSNLEAILVARDHWGRPKAHGGDLFRAQLLGPELRAGVPGEVK
DLENGTYLLSFPLLWAGWAQVQVRLIHSSEAVGVLQRVWRGKRATVDFRGHFRGTNGIQE
TVICNVDPQSTGAKGSTCHYKDVVSGEIWFCAQPRTLPCNALVGHSSGSYLKVTTPHDQD
LLAGNVTDQKLPSSLPPILVLPAAWGNMSNMALPSRPPCLPGHLSPKPSGFYHQDRWHST
FCSSRSFPTVDSILNCLAGRIVYMMGDSTLRQWWEYLRDTVPSLKPVDLHATYEVGPLMA
VETTRGTVLHWRAHSWPLRSRLTPVASLHSVARELYGLAGGPYTVVVLGMGAHFTTFPPS
IFARRLAGIRAAVKALLDREPSTLVVIKLANTGYKSVYGSDWLTLQMNRFLRAAFVGLRV
AFVDAWEMTSSLAVPDNIHPRKLIVRNEVELFLSFICPT
Download sequence
Identical sequences F1M059
ENSRNOP00000056776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]