SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056797 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056797
Domain Number 1 Region: 88-167
Classification Level Classification E-value
Superfamily E set domains 0.00000000521
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000056797
Domain Number - Region: 427-525
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0189
Family Acetylhydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056797   Gene: ENSRNOG00000031343   Transcript: ENSRNOT00000060048
Sequence length 542
Comment pep:novel chromosome:Rnor_5.0:12:21486728:21498102:-1 gene:ENSRNOG00000031343 transcript:ENSRNOT00000060048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQFKKYKILTVGLVFLVLVFCLMTTWHEPMIHWLEQPRPVSEDVSESIDWDSLSQELPN
LTNLLYWPPTGGDRDDFLASTSPRTSTYHLKGPAQANYTLGSNLEAILVARDHWGRPKAH
GGDLFRAQLLGPELRAGVPGDVKDLENGTYLLSFPLLWAGWAQVQVRLIHSSEAVGVLQR
VWREKRATVDFRGYFRGANGTQETVICNVDPQSTGAKGSTCQYKDVVSGEIWFCAQPRTL
PCNALVGHSSGSYLKVTTPHDEDLLAGNVTDQKLPSGIPPILVLQAAQENMENTALPSRP
PCHPGHLSPKPSGFYHQDRWHSTFCSSRPFPTVDSILNCLAGRIVYMMGDSTLRQWWEYL
RDTVPSLKPVDLHATYQVGPLMAVETTRGTVLHWRAHSWPLRSLRTPVASLHSVARELHG
LAGGPYTVVVLGMGAHFTTFPPSIFARRLAGIRAAVKALLDREPSTLVVIKLANTGYKSV
YGSDWLTLQMNRFLRAAFVGLRVAFVDAWEMTSSLAVPDDIHPRKLIVRNEVELFLSFIC
PT
Download sequence
Identical sequences D3ZUM7
ENSRNOP00000056797 ENSRNOP00000056797 10116.ENSRNOP00000056797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]