SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000057009 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000057009
Domain Number 1 Region: 33-142
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.7e-24
Family Peptidyl-tRNA hydrolase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000057009   Gene: ENSRNOG00000049034   Transcript: ENSRNOT00000060258
Sequence length 208
Comment pep:known chromosome:Rnor_5.0:3:17148932:17162610:1 gene:ENSRNOG00000049034 transcript:ENSRNOT00000060258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVRMLKSGLFCPGMRRSWTLSRQVSEARFPGKRWLVAGLGNPGMPGTRHSVGMAVLGQIA
QRLGVAENWARDSRCAADLALAPFGDAQLVLLRPRRLMNVNGRSVAKAAELFGLSAEEIY
LVHDELDKPLGKLALKLGGSASFFSVSSSFCGVRMCVDPGKAEKTVSSLTYCSLRLLSPT
LHPPNPGLGPVEARRGLGMEPLGPRYLG
Download sequence
Identical sequences F1M8A9
ENSRNOP00000057009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]