SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000057102 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000057102
Domain Number 1 Region: 153-253,421-492
Classification Level Classification E-value
Superfamily TrmE connector domain 8.5e-43
Family TrmE connector domain 0.0028
Further Details:      
 
Domain Number 2 Region: 104-184,221-411
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.93e-35
Family G proteins 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000057102   Gene: ENSRNOG00000023403   Transcript: ENSRNOT00000060355
Sequence length 492
Comment pep:known chromosome:Rnor_5.0:16:19758699:19763790:1 gene:ENSRNOG00000023403 transcript:ENSRNOT00000060355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLSALVTRPASAPLRLCARCSTGAESLVPGSTIFALSSGQGRCAIAVIRTSGPASGL
ALRSLTALREPPPARSACLRLLRHPCSGEPLDRSLVLWFPGPQSFTGEDCMELHVHGGPA
VVSGVLQALGSVPGLRPAKAGEFTRRAFAHGKLSLTEVEGLADLIHAETEAQRRQALRQL
DGELSQLCQGWAKTLTKALAHVEAYIDFGEDDNLEEGVLEQVDRDVRALEVALSSHLRDA
RRGQRLRSGANVVVAGPPNAGKSSLVNLLSQKPVSIVSPEPGTTRDILETPVDLAGFPVL
LSDTAGLREGAGAVEQEGVRRARQRLEQADIILGMLDASDLASSSSCSFLDTVVAPLVAQ
SHDSGRQRLLLLLNKSDLLSANAPASSTALPPHLLLSCHTGAGMDALLQALKTELAAVCG
DPSTGPPLLTRARHQYHLQGCLDALGRFQLTTDLALAAEALRQARRQLSHLTGGGGTEEI
LDLIFQDFCVGK
Download sequence
Identical sequences Q5PQQ1
10116.ENSRNOP00000057102 ENSRNOP00000057102 ENSRNOP00000057102 NP_001011919.1.100692 NP_001011919.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]