SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000057155 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000057155
Domain Number 1 Region: 1326-1464
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 235-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000103
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000057155   Gene: ENSRNOG00000008741   Transcript: ENSRNOT00000060410
Sequence length 1470
Comment pep:known chromosome:Rnor_5.0:13:58197543:58276568:-1 gene:ENSRNOG00000008741 transcript:ENSRNOT00000060410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREVRRTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTETVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAHKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKSKEHHTAEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPAVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNHCCHFSLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPAKDMPS
VPVLNAAKRNVLDSSSSSDFTSRYTRPQTHSSVSGGIRRSSSMSYVDGFIGTWPKEKRTS
VHGVSFDISFDKEDNAQSSTPNRGIIRSVSNEGLNNSRASKHIRKNLSFKPVNGGEEESI
EEELHVDPHGDLKSYMPLSTNELNSNENTHHKLPNGALQNRVLLDEFGNQIETPSIEEAL
QIIHDTEKPPHTARPDQIANGFFLHGQDLSLLNSNIKLSQSSPDNITDPKGALSPITDTT
EVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRASNPREALSPCPS
TISTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQKTTPEGSELNIPHMVS
WAQIPEESGVAQGRDTTQLLASEMVHLRMRLEEKRRAIEAQKKKMEAAFTKQRQKMGRTA
FLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKESQKMDGQRSKSLADIKESMENPQG
KWLKSPSTPVDPEKQWNLTSPSEETLNEGELLEYTKSIEKLNSSLHFLQQEMQRLSLQQE
MLMQMREQQSWVISPPQPSPQKQIRDFKPRQAGLSSAAAPFSADSPRPTHPSPQSSTRKS
ASFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQTRSFVCFGDDGE
PQKEPKPKEEIKKEPSECKGTLESCDHNPGEKEVKPLESTVSEVLSQPITETVCVTPNED
QLNQPTDPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADVSVEKFDGESDKEQFDDDQKV
CCGFFFKDDQKAENDMAVKRAALLEKRLRREKETQLRKQQLEAEMEHRKEETRRKTEEER
QKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVAKQKKQRPKSIHRDHIESPKT
PIKGPPVSSLSLASLNTGDTESVHSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTTS
SVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNFL
ILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKTL
SASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences D4AEC2
NP_001127975.1.100692 NP_001127975.1.4139 ENSRNOP00000057155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]