SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000057961 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000057961
Domain Number - Region: 121-193
Classification Level Classification E-value
Superfamily DNA clamp 0.0848
Family DNA polymerase III, beta subunit 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000057961   Gene: ENSRNOG00000019232   Transcript: ENSRNOT00000061249
Sequence length 341
Comment pep:known chromosome:Rnor_5.0:17:8887525:8895096:1 gene:ENSRNOG00000019232 transcript:ENSRNOT00000061249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPMPLPPRESARFVAENSRDVGVDREGVRRVAELLLPAAVAWRLEQWKALHELNPRGS
DEAALDWVFMVDSLNFSFWAEREERKCEVRYGGTAYTGYWALCAAVNRALDQGIPVTSAS
YYATVTLDQVRNIFRSDTAVPMPLLEERHRILNETGKILLEKFGGSFLNCVQKSGKSAQK
LMHLIVENFPSYRDEAWFEGKRISFYKRAQILVADTWSVLEGKGDGSFEDISSITMFADY
RLPQILAHLGALKYSDELLKKLLEGEMLLNGDKQEVEIRGCSIWCVELIRDCLVELLEKR
GESPPVEVNAILLDYHLWDYAREHRDGMKGVPFHRTRCIYY
Download sequence
Identical sequences F7FM32
ENSRNOP00000057961 NP_001166907.1.100692 NP_001166907.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]