SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059783 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059783
Domain Number 1 Region: 129-368
Classification Level Classification E-value
Superfamily vWA-like 1.11e-70
Family Integrin A (or I) domain 0.00000184
Further Details:      
 
Domain Number 2 Region: 1129-1313
Classification Level Classification E-value
Superfamily Fibronectin type III 5.51e-36
Family Fibronectin type III 0.00000337
Further Details:      
 
Domain Number 3 Region: 1509-1710
Classification Level Classification E-value
Superfamily Fibronectin type III 5.78e-35
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 4 Region: 991-1109
Classification Level Classification E-value
Superfamily CalX-like 3.53e-20
Family CalX-beta domain 0.00085
Further Details:      
 
Domain Number 5 Region: 626-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.02e-17
Family Integrin beta tail domain 0.0029
Further Details:      
 
Domain Number 6 Region: 27-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000277
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000059783
Domain Number - Region: 580-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number - Region: 508-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Domain Number - Region: 467-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0781
Family Integrin beta EGF-like domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059783   Gene: ENSRNOG00000005580   Transcript: ENSRNOT00000065339
Sequence length 1806
Comment pep:known chromosome:Rnor_5.0:10:103725177:103761362:-1 gene:ENSRNOG00000005580 transcript:ENSRNOT00000065339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLCSSPWVKLLLAVVLSAGLPGNMANRCKKAQVKSCTECIRVDKSCAYCTDELFKERR
CNTQAELLAAGCRGESVLVMESSLEITENIQIDTSLHRSQVSPQGLQVRLRPGEERNFVF
KVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTENVEEFWDKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDATGAYTQYK
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELLE
EAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDIDG
THVCQMAKEDQRGNIHLKPSFSDGLRMDASVICDVCACELQKEVQSARCHYRGDFMCGHC
VCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEYD
NFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGLGFCECG
RCHCNQRSSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMV
DELKKAEEVVEYCSFRDEDDDCTYSYTVEGDGSPGPNSTVLVHKKKDCLPAPSWLIPLLI
FLLLLLVLLLLLCWKYCACCKACLGLLPCCNQGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDTVRWKITNNVQRPGFATHAASISPTELVPYGLSLRLGRLCTENLMKPGTRE
CDQLRQEVEENLNEVYRQVNGVHKLQQTKFRQQPNAGKKQDHTIVDTVLLAPRSAKQSLL
KLTEKQVEQGSFHELKVAPGYYTLTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYSVSRGDQVARIPVIRHILDN
GKSQVSYSTQDNTAHGHRDYVPVEGELLFYPGETWKELQVKLLELQEVDSLLRGRQVRRF
QVQLSNPKFGARLGQPNTATVIIGEQDETDRSLINEISASPPLPRGDLGAPQNPNAKAAG
SRKIHFNWLPPPGKPMGYRVKYWVQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAHGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTEHLVNGRMDF
AYPGSANSLHRMTAANVAYGTHLSPHQTHRMLSTSSTLTRDYHSLTRTDHSQSGTLPRDY
STLTSLSSQGLPPIWEDGRSRLPLSWTLGSWSRAQMKGVPASRGSPDSIILAGQSAAPSW
GTDSRGAMGVPDTPTRLVFSALGPTSLKVSWQEPQCDRALLGYSVEYQLLNGGEMHRLNI
PNPGQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAFT
LSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGGPARTFRVDGDNP
ESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHSGLFQNPLQ
SEYSTVTSTHSTTTTEPFLIDGLTLGTQRLEAGGSLTRHVTQEFVSRTLTTSGSLSTHMD
QQFFQT
Download sequence
Identical sequences F1LSD3
ENSRNOP00000059783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]