SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060064 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060064
Domain Number 1 Region: 6-201
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.45e-76
Family T-box 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060064   Gene: ENSRNOG00000019565   Transcript: ENSRNOT00000067358
Sequence length 226
Comment pep:known chromosome:Rnor_5.0:2:220812286:220855072:1 gene:ENSRNOG00000019565 transcript:ENSRNOT00000067358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSMEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIV
PVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNEL
DDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQ
QITRLKIDRNPFAKGFRDSGRNRTGLEAIMETYAFWRPPTHTHTFT
Download sequence
Identical sequences NP_001099921.1.100692 NP_001099921.1.4139 ENSRNOP00000060064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]