SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060322 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060322
Domain Number 1 Region: 368-478,589-737
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.18e-51
Family Phosphate binding protein-like 0.0000123
Further Details:      
 
Domain Number 2 Region: 2-352
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-26
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000060322
Domain Number - Region: 496-582
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0181
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060322   Gene: ENSRNOG00000006174   Transcript: ENSRNOT00000064696
Sequence length 933
Comment pep:known chromosome:Rnor_5.0:4:159485887:160229216:1 gene:ENSRNOG00000006174 transcript:ENSRNOT00000064696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWHAVLAACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLT
RSNRNDDYTLSVRPPVYLNEVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMD
VALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFISEVVETNLVAF
DCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKD
PFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIK
KGGVNGLTGDLEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKL
ENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDH
KYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEK
TVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYG
SFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQ
TDIPYGTVLDSAVYQHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKY
GNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPYRDVFSQRILELQQS
GDMDILKHKWWPKNGQCDLYSSVDAKQKGGALDIKSLAGVFCILAAGIVLSCLIAVLETW
WSRRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQ
ALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGSVPEHRTGPFRHRAPNGGF
FRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences F1LXB6
ENSRNOP00000060322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]